Igg Monoclonal Antibody Santacruz

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg monoclonal antibody santacruz reagents distributed by Genprice. The Igg Monoclonal Antibody Santacruz reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Antibody Santacruz

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Dog True insulin ELISA kit

192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog True insulin ELISA kit

1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Antibody Santacruz information

CAY-10683, Santacruzamate A

MBS130786-500mg 500mg
EUR 2775

CAY10683 (SantacruzaMate A)

MBS576522-10mg 10mg
EUR 150

CAY10683 (SantacruzaMate A)

MBS576522-25mg 25mg
EUR 190

CAY10683 (SantacruzaMate A)

MBS576522-2mg 2mg
EUR 125

CAY10683 (SantacruzaMate A)

MBS576522-50mg 50mg
EUR 260

CAY10683 (SantacruzaMate A)

MBS576522-5mg 5mg
EUR 140

OOMC00058-5MG - Santacruzamate A

OOMC00058-5MG 5mg
EUR 59

OOMC00058-25MG - Santacruzamate A

OOMC00058-25MG 25mg
EUR 219

Human IgG Monoclonal Antibody

UB-GEN-4358 100 ul
EUR 200

IgG (5B2) monoclonal antibody

MB3064 50ul
EUR 398
Description: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3.

IgG (H+L) Monoclonal Antibody

MBS7135212-005mg 0.05mg
EUR 150

IgG (H+L) Monoclonal Antibody

MBS7135212-01mg 0.1mg
EUR 190

IgG (H+L) Monoclonal Antibody

MBS7135212-5x01mg 5x0.1mg
EUR 845

Anti-Monkey IgG Monoclonal Antibody

MBS190019-01mg 0.1mg
EUR 280

Anti-Monkey IgG Monoclonal Antibody

MBS190019-05mg 0.5mg
EUR 490

Anti-Monkey IgG Monoclonal Antibody

MBS190019-1mg 1mg
EUR 930

Anti-Monkey IgG Monoclonal Antibody

MBS190019-5x1mg 5x1mg
EUR 4170