Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the igg monoclonal antibody santacruz reagents distributed by Genprice. The Igg Monoclonal Antibody Santacruz reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Antibody Santacruz
Antibody Santacruz information
CAY-10683, Santacruzamate A |
|
MBS130786-500mg |
MyBiosource |
500mg |
EUR 2775 |
CAY10683 (SantacruzaMate A) |
|
MBS576522-10mg |
MyBiosource |
10mg |
EUR 150 |
CAY10683 (SantacruzaMate A) |
|
MBS576522-25mg |
MyBiosource |
25mg |
EUR 190 |
CAY10683 (SantacruzaMate A) |
|
MBS576522-2mg |
MyBiosource |
2mg |
EUR 125 |
CAY10683 (SantacruzaMate A) |
|
MBS576522-50mg |
MyBiosource |
50mg |
EUR 260 |
CAY10683 (SantacruzaMate A) |
|
MBS576522-5mg |
MyBiosource |
5mg |
EUR 140 |
Human IgG Monoclonal Antibody |
|
UB-GEN-4358 |
UpingBio |
100 ul |
EUR 200 |
IgG (5B2) monoclonal antibody |
|
MB3064 |
Bioworld Biotech |
50ul |
EUR 398 |
|
|
|
Description: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3. |
IgG (H+L) Monoclonal Antibody |
|
MBS7135212-005mg |
MyBiosource |
0.05mg |
EUR 150 |
IgG (H+L) Monoclonal Antibody |
|
MBS7135212-01mg |
MyBiosource |
0.1mg |
EUR 190 |
IgG (H+L) Monoclonal Antibody |
|
MBS7135212-5x01mg |
MyBiosource |
5x0.1mg |
EUR 845 |
Anti-Monkey IgG Monoclonal Antibody |
|
MBS190019-01mg |
MyBiosource |
0.1mg |
EUR 280 |
Anti-Monkey IgG Monoclonal Antibody |
|
MBS190019-05mg |
MyBiosource |
0.5mg |
EUR 490 |
Anti-Monkey IgG Monoclonal Antibody |
|
MBS190019-1mg |
MyBiosource |
1mg |
EUR 930 |
Anti-Monkey IgG Monoclonal Antibody |
|
MBS190019-5x1mg |
MyBiosource |
5x1mg |
EUR 4170 |