Human Monoclonal Antibody Prophylactics

Monoclonal antibody for SUR1 and SUR2B
SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody prophylactics reagents distributed by Genprice. The Human Monoclonal Antibody Prophylactics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Prophylactics

True Blue Chloride
100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural
PK10
EUR 129.6

True Blue Diaceturate Salt
100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt
1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt
5mg Ask for price
Description: 108321-12-6

Porcine True insulin ELISA kit
96T
EUR 700
Description: ELISA

Goat True insulin ELISA kit
96T
EUR 700
Description: ELISA

Antibody Prophylactics information

Human CD4 Monoclonal antibody
4CFB-100T 100 test
EUR 292.6

Human CD4 Monoclonal antibody
4F-100T 100 test
EUR 215.6

Human CD4 Monoclonal antibody
4PE-100T 100 test
EUR 266.2

Human CD4 Monoclonal antibody
4PP-100T 100 test
EUR 290.4

Human CD4 Monoclonal antibody
4PPC5.5-100T 100 test
EUR 292.6

Human CD6 Monoclonal antibody
6A-100T 100 test
EUR 259.6

Human CD6 Monoclonal antibody
6F-100T 100 test
EUR 215.6

Human CD6 Monoclonal antibody
6PE-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody
5A-100T 100 test
EUR 276.1

Human CD5 Monoclonal antibody
5A1-100T 100 test
EUR 248.6

Human CD5 Monoclonal antibody
5F-100T 100 test
EUR 221.1

Human CD5 Monoclonal antibody
5F1-100T 100 test
EUR 204.6

Human CD5 Monoclonal antibody
5PE1-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody
5PPC5.51-100T 100 test
EUR 292.6

Human CD7 Monoclonal antibody
7A-100T 100 test
EUR 264

Human CD7 Monoclonal antibody
7F-100T 100 test
EUR 209

Human CD7 Monoclonal antibody
7PE-100T 100 test
EUR 297