Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Ige Monoclonal Laboratories manufactures the ige monoclonal antibody omalizumab reagents distributed by Genprice. The Ige Monoclonal Antibody Omalizumab reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Monoclonal Group: Antibody Omalizumab
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Antibody Omalizumab information
Immunoglobulin E (IgE) Monoclonal Antibody (Pig) |
4-MAA545Po21 |
Cloud-Clone |
-
EUR 320.40
-
EUR 3391.20
-
EUR 836.40
-
EUR 405.60
-
EUR 266.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE) |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE |
4-MAA545Po21-PE |
Cloud-Clone |
-
EUR 384.00
-
EUR 3582.00
-
EUR 1003.20
-
EUR 487.20
-
EUR 246.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE. |
Anti-Human IgE, Rabbit Monoclonal Antibody |
A1800-50 |
Biovision |
each |
EUR 392.4 |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP |
4-MAA545Po21-HRP |
Cloud-Clone |
-
EUR 410.40
-
EUR 3874.80
-
EUR 1081.20
-
EUR 522.00
-
EUR 261.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC |
4-MAA545Po21-APC |
Cloud-Clone |
-
EUR 450.00
-
EUR 4448.40
-
EUR 1224.00
-
EUR 579.60
-
EUR 278.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3 |
4-MAA545Po21-Cy3 |
Cloud-Clone |
-
EUR 550.80
-
EUR 5881.20
-
EUR 1582.80
-
EUR 722.40
-
EUR 321.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC |
4-MAA545Po21-FITC |
Cloud-Clone |
-
EUR 384.00
-
EUR 3582.00
-
EUR 1003.20
-
EUR 487.20
-
EUR 246.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Biotinylated |
4-MAA545Po21-Biotin |
Cloud-Clone |
-
EUR 399.60
-
EUR 3331.20
-
EUR 967.20
-
EUR 494.40
-
EUR 273.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Biotin. |
Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC-Cy7 |
4-MAA545Po21-APC-Cy7 |
Cloud-Clone |
-
EUR 757.20
-
EUR 8752.80
-
EUR 2305.20
-
EUR 1015.20
-
EUR 412.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC-Cy7. |
Mouse IgE Monoclonal Antibody, Isotype Control, Clone 2A101A12 |
7129 |
Chondrex |
1 mg/ml x 0.5 ml |
EUR 580.26 |
Description: Mouse IgE Monoclonal Antibody |
Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody |
CABT-54633RM |
Creative Diagnostics |
0.25 mg |
EUR 795.6 |