Human Nature Killer Cell (NK cell) ELISA Kit |
abx257238-96tests |
Abbexa |
96 tests |
EUR 764.4 |
|
Human Antibody Laboratories manufactures the humanized monoclonal antibody nature reagents distributed by Genprice. The Humanized Monoclonal Antibody Nature reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antibody Nature
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Antibody Nature information
Anti-PD-1 (Toripalimab), Humanized Antibody |
A2161-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-1 (Camrelizumab) humanized Antibody |
A2132-100 |
Biovision |
100 µg |
EUR 636 |
Anti-Dabigratan (Idarucizumab), Humanized Antibody |
A2169-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-L1 (Atezolizumab), humanized Antibody |
A1305-100 |
Biovision |
each |
EUR 601.2 |
Anti-PD-1 (Pembrolizumab), humanized Antibody |
A1306-100 |
Biovision |
each |
EUR 601.2 |
Anti-PD-1 (Spartalizumab) humanized Antibody |
A2131-100 |
Biovision |
100 µg |
EUR 636 |
Anti-IL-5Rα (Benralizumab), Humanized Antibody |
A2162-100 |
Biovision |
100 µg |
EUR 612 |
Anti-IL-23α (Tildrakizumab), Humanized Antibody |
A2159-100 |
Biovision |
100 µg |
EUR 612 |
Anti-α4β7 Integrin (Vedolizumab), Humanized Antibody |
A2140-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CD79B (Polatuzumab Vedotin), Humanized Antibody |
A2178-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CD22 (Inotuzumab Ozogamicin), Humanized Antibody |
A2179-100 |
Biovision |
100 µg |
EUR 612 |
Anti-TROP2 (Sacituzumab Govitecan), Humanized Antibody |
A2175-100 |
Biovision |
100 µg |
EUR 612 |
Anti-TNF-α (Certolizumab Pegol), Humanized Antibody |
A2142-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CD57 / B3GAT1 (Natural Killer Cell Marker) Monoclonal Antibody |
M09548 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Mouse Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody. Validated in IHC and tested in Human. |
Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody, Clone: NK/804 |
AMM00761G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD57 / B3GAT1 (Natural Killer Cell Marker). The antibodies are raised in Mouse and are from clone NK/804. This antibody is applicable in IHC, IF |
Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody, Clone: NK-1 |
AMM00752G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD57 / B3GAT1 (Natural Killer Cell Marker). The antibodies are raised in Mouse and are from clone NK-1. This antibody is applicable in IHC, IF |