Humanized Monoclonal Antibody Nature

Human Nature Killer Cell (NK cell) ELISA Kit

abx257238-96tests 96 tests
EUR 764.4

Human Antibody Laboratories manufactures the humanized monoclonal antibody nature reagents distributed by Genprice. The Humanized Monoclonal Antibody Nature reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antibody Nature

True north Cryobox 50mLBlue

PK10
EUR 210

True north Cryobox1.5/2mLNatural

PK10
EUR 162

True north Cryobox1.5/2.0mLGreen

PK10
EUR 162

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Antibody Nature information

Anti-PD-1 (Toripalimab), Humanized Antibody

A2161-100 100 µg
EUR 612

Anti-PD-1 (Camrelizumab) humanized Antibody

A2132-100 100 µg
EUR 636

Anti-Dabigratan (Idarucizumab), Humanized Antibody

A2169-100 100 µg
EUR 612

Anti-PD-L1 (Atezolizumab), humanized Antibody

A1305-100 each
EUR 601.2

Anti-PD-1 (Pembrolizumab), humanized Antibody

A1306-100 each
EUR 601.2

Anti-PD-1 (Spartalizumab) humanized Antibody

A2131-100 100 µg
EUR 636

Anti-IL-5Rα (Benralizumab), Humanized Antibody

A2162-100 100 µg
EUR 612

Anti-IL-23α (Tildrakizumab), Humanized Antibody

A2159-100 100 µg
EUR 612

Anti-α4β7 Integrin (Vedolizumab), Humanized Antibody

A2140-100 100 µg
EUR 612

Anti-CD79B (Polatuzumab Vedotin), Humanized Antibody

A2178-100 100 µg
EUR 612

Anti-CD22 (Inotuzumab Ozogamicin), Humanized Antibody

A2179-100 100 µg
EUR 612

Anti-TROP2 (Sacituzumab Govitecan), Humanized Antibody

A2175-100 100 µg
EUR 612

Anti-TNF-α (Certolizumab Pegol), Humanized Antibody

A2142-100 100 µg
EUR 612

pdCas9- humanized Plasmid

PVT6322 2 ug
EUR 319.2

Anti-CD57 / B3GAT1 (Natural Killer Cell Marker) Monoclonal Antibody

M09548 100ug/vial
EUR 476.4
Description: Mouse Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody. Validated in IHC and tested in Human.

Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody, Clone: NK/804

AMM00761G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD57 / B3GAT1 (Natural Killer Cell Marker). The antibodies are raised in Mouse and are from clone NK/804. This antibody is applicable in IHC, IF

Monoclonal CD57 / B3GAT1 (Natural Killer Cell Marker) Antibody, Clone: NK-1

AMM00752G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD57 / B3GAT1 (Natural Killer Cell Marker). The antibodies are raised in Mouse and are from clone NK-1. This antibody is applicable in IHC, IF