Igg Monoclonal Antibody Purificatoin

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg monoclonal antibody purificatoin reagents distributed by Genprice. The Igg Monoclonal Antibody Purificatoin reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Antibody Purificatoin

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Dog True insulin ELISA kit

192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog True insulin ELISA kit

1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Antibody Purificatoin information

Rabbit IgG Light Chain mouse monoclonal antibody, clone SB62a, Purified

AM08098PU-N 500 µg Ask for price

Chicken IgG / Chicken IgY mouse monoclonal antibody, clone 4G12, Purified

AM00073PU-N 100 µg Ask for price

Chicken IgG / Chicken IgY mouse monoclonal antibody, clone 14B11, Purified

AM31999PU-N 100 µg Ask for price

Human IgG (Fc specific) mouse monoclonal antibody, clone B1521M, Purified

AM33403PU-N 1 mg Ask for price

Human IgG (heavy chain) mouse monoclonal antibody, clone B33/20, Purified

BM476 1 mg Ask for price

Rat IgG Light Chain mouse monoclonal antibody, clone KT100, Aff - Purified

AM20829PU-L 1 mg Ask for price

Rat IgG Light Chain mouse monoclonal antibody, clone KT100, Aff - Purified

AM20829PU-N 200 µg Ask for price

Rat IgG Light Chain mouse monoclonal antibody, clone KT100, Aff - Purified

AM20829PU-S 100 µg Ask for price

Human IgG (Fc specific) mouse monoclonal antibody, clone 21G/3D3, Purified

AM31555PU-N 1 mg Ask for price

Rabbit IgG (heavy chain) rat monoclonal antibody, clone RG-1, Aff - Purified

BM499 500 µg Ask for price

Mouse IgG (heavy chain) rat monoclonal antibody, clone LO-MG-7, Purified

AM32194PU-N 1 ml Ask for price

Human IgG (F(ab)2 specific) mouse monoclonal antibody, clone 4A11, Purified

SM3062P 100 µg Ask for price

Bovine IgG (light chain) mouse monoclonal antibody, clone IVA285-1, Purified

AM03077PU-N 100 µg Ask for price

Mouse IgG (heavy chain) rat monoclonal antibody, clone LO-MG-7, HRP, Purified

AM32194HR-N 1 ml Ask for price

Mouse IgG (heavy chain) rat monoclonal antibody, clone LO-MG-7, FITC, Purified

AM32194FC-N 1 ml Ask for price

Human IgG (Fc CH2 Domain specific) mouse monoclonal antibody, clone 8A4, Purified

AM01157PU-N 200 µg Ask for price

Mouse IgG (heavy chain) rat monoclonal antibody, clone LO-MG-7, Biotin, Purified

AM32194BT-N 1 ml Ask for price