Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Igg Antibody Laboratories manufactures the igg monoclonal antibody purificatoin reagents distributed by Genprice. The Igg Monoclonal Antibody Purificatoin reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Antibody Purificatoin
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Antibody Purificatoin information
Rat Monoclonal Anti-Mouse CD147, Purified (Clone OX114) (rat IgG1) |
MCD147-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD200, Purified (Clone OX90) (rat IgG2a) |
MCD200-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD45, Purified (Clone IBL-5/25) (rat IgG1) |
MCD045-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD49d, Purified (Clone R1-2) (rat IgG2b) |
MCD049D-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD134, Purified (Clone OX-86)(rat IgG1) |
MCD134-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD5 Purified (Clone OX-19) (mouse IgG1) |
RCD005-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD45 Purified (Clone OX-1) (mouse IgG1) |
RCD045-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |
Mouse Monoclonal Anti-Human CD59, (Purified) (Clone 1F5) (mouse IgG1) |
CD59UL-100 |
Alpha Diagnostics |
100 ug |
EUR 416.4 |
Rat Monoclonal Anti-Mouse CD157, Purified (Clone KT157) (Rat IgG2c) |
MCD157-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD28 Purified (Clone JJ319) (mouse IgG1) |
RCD028-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD45RC, Purified (Clone IBL-8) (rat IgG1) |
MCD045RC-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD80, Purified (Clone RMMP-1) (rat IgG2a) |
MCD080-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD86, Purified (Clone RMMP-2) (rat IgG2a) |
MCD086-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Rat Monoclonal Anti-Mouse CD94, Purified, (clone: 15F.18D1), (rat IgG1k) |
MCD094-M |
Alpha Diagnostics |
100 ug |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD11a Purified (Clone WT.1) (mouse IgG2a) |
RCD011A-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD48 Purified (Clone OX-45) (mouse IgG1) |
RCD048-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |
Mouse Monoclonal Anti-Rat CD152 Purified (Clone WKH 203 ) (mouse IgG1 ) |
RCD152-M |
Alpha Diagnostics |
100 tests |
EUR 578.4 |