Mouse anti-human Fibrin/Fibrinogen degradation products (FDP) monoclonal antibody |
|
MBS7137093-1mg |
MyBiosource |
1mg |
EUR 185 |
Human Monoclonal Laboratories manufactures the human monoclonal antibody products reagents distributed by Genprice. The Human Monoclonal Antibody Products reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Products
Monoclonal PP2A alpha and beta Antibody |
|
Leading Biology |
0.1ml |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Antibody Products information
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), PE |
|
4-MAB353Ge21-PE |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with PE. |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), APC |
|
4-MAB353Ge21-APC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with APC. |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), Cy3 |
|
4-MAB353Ge21-Cy3 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with Cy3. |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), FITC |
|
4-MAB353Ge21-FITC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with FITC. |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), HRP |
|
4-MAB353Ge21-HRP |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with HRP. |
PE-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054212-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054214-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Cy3-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054216-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
HRP-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054219-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), APC-Cy7 |
|
4-MAB353Ge21-APC-Cy7 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with APC-Cy7. |
FITC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054217-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC/CY7-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2054210-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Biotin-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE) |
|
MBS2091058-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Advanced Glycation End Product (AGE) Monoclonal Antibody (General), Biotinylated |
|
4-MAB353Ge21-Biotin |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
|
|
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with Biotin. |
Monoclonal Anti-BrdU produced in mouse Antibody |
|
MBS415152-01mL |
MyBiosource |
0.1mL |
EUR 365 |
Monoclonal Anti-BrdU produced in mouse Antibody |
|
MBS415152-5x01mL |
MyBiosource |
5x0.1mL |
EUR 1395 |
Fibrinogen Degradation Product D (D-Dimer) mouse monoclonal antibody, clone DD-5, Purified |
|
BM417 |
Origene Technologies GmbH |
200 µg |
Ask for price |