Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the human monoclonal antibody products reagents distributed by Genprice. The Human Monoclonal Antibody Products reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Products
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Antibody Products information
Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), Biotinylated |
4-PAB223Hu05-Biotin |
Cloud-Clone |
-
EUR 363.60
-
EUR 2800.80
-
EUR 835.20
-
EUR 441.60
-
EUR 258.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with Biotin. |
anti-Rabies G antigen monoclonal antibody. Produced against a recombinant protein. |
010-A |
Virogen |
1 MG |
EUR 850 |
anti-Rabies G antigen monoclonal antibody. Produced against a recombinant protein. |
010-A-100ugvial |
Virogen |
100 ug/vial |
EUR 150 |
|
Description: anti-Rabies G antigen monoclonal antibody. Produced against a recombinant protein. |
Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody |
CAU30405-100ul |
Biomatik Corporation |
100ul |
EUR 222.7 |
Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody |
CAU30405-200ul |
Biomatik Corporation |
200ul |
EUR 278.9 |
Goat Anti Advanced Glycated End Products Polyclonal Antibody |
DPBT-66761GA |
Creative Diagnostics |
0.1 ml |
EUR 858 |
Human fibrin(ogen) degradation products Mab |
QZBFDP14-3-7 |
Quickzyme |
500 ug IgG |
EUR 910.8 |
Human Advanced oxidation protein products ELISA kit |
E01A0832-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Human Advanced oxidation protein products in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Advanced oxidation protein products ELISA kit |
E01A0832-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Human Advanced oxidation protein products in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Advanced oxidation protein products ELISA kit |
E01A0832-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Human Advanced oxidation protein products in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Advanced oxidation protein products ELISA kit |
E01A0360 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Human fibrin degradation products plm generated Mab |
QZBFBDDE2 |
Quickzyme |
500 ug IgG |
EUR 910.8 |
Human Advanced Glycosylation End Products ELISA kit |
E01A0002 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Human Advanced Oxidation Protein Products (AOPP) Protein |
20-abx651587 |
Abbexa |
-
EUR 510.00
-
EUR 276.00
-
EUR 1378.80
-
EUR 594.00
-
EUR 376.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human advanced glycation end products,AGEs ELISA Kit |
201-12-0004 |
SunredBio |
96 tests |
EUR 528 |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human advanced glycation end products,AGEs ELISA Kit |
CN-04128H1 |
ChemNorm |
96T |
EUR 567.6 |
Human advanced glycation end products,AGEs ELISA Kit |
CN-04128H2 |
ChemNorm |
48T |
EUR 387.6 |