Human Monoclonal Antibody Products

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibody products reagents distributed by Genprice. The Human Monoclonal Antibody Products reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Products

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Antibody Products information

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), PE

4-PAB223Hu05-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with PE.

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), APC

4-PAB223Hu05-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with APC.

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), Cy3

4-PAB223Hu05-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with Cy3.

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), FITC

4-PAB223Hu05-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with FITC.

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), HRP

4-PAB223Hu05-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with HRP.

Custom Production of Monoclonal antibodies (immunization, ELISA Kit, fusion, screening, Cloning of up to 3 clones)

MAB-1 1
EUR 12483.6

Advanced Oxidation Protein Products (AOPP) Antibody

20-abx178961
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Advanced Oxidation Protein Products (AOPP) Antibody

abx178961-96tests 96 tests
EUR 262.5

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), APC-Cy7

4-PAB223Hu05-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with APC-Cy7.

Advanced Oxidation Protein Products (AOPP) Polyclonal Antibody (Human), Biotinylated

4-PAB223Hu05-Biotin
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Advanced Oxidation Protein Products (AOPP). This antibody is labeled with Biotin.

Human CD6 Monoclonal antibody

6A-100T 100 test
EUR 259.6

Human CD6 Monoclonal antibody

6F-100T 100 test
EUR 215.6

Human CD6 Monoclonal antibody

6PE-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody

5A-100T 100 test
EUR 276.1

Human CD5 Monoclonal antibody

5A1-100T 100 test
EUR 248.6

Human CD5 Monoclonal antibody

5F-100T 100 test
EUR 221.1

Human CD5 Monoclonal antibody

5F1-100T 100 test
EUR 204.6