Human Monoclonal Antibody Products

Mouse anti-human Fibrin/Fibrinogen degradation products (FDP) monoclonal antibody

MBS7137093-1mg 1mg
EUR 185

Human Monoclonal Laboratories manufactures the human monoclonal antibody products reagents distributed by Genprice. The Human Monoclonal Antibody Products reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Products

True Blue

50mg Ask for price
Description: True Blue

True Blue

5mg Ask for price
Description: True Blue

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Antibody Products information

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), PE

4-MAB353Ge21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with PE.

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), APC

4-MAB353Ge21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with APC.

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), Cy3

4-MAB353Ge21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with Cy3.

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), FITC

4-MAB353Ge21-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with FITC.

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), HRP

4-MAB353Ge21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with HRP.

PE-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054212-INQUIRE INQUIRE Ask for price

APC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054214-INQUIRE INQUIRE Ask for price

Cy3-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054216-INQUIRE INQUIRE Ask for price

HRP-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054219-INQUIRE INQUIRE Ask for price

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), APC-Cy7

4-MAB353Ge21-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with APC-Cy7.

FITC-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054217-INQUIRE INQUIRE Ask for price

APC/CY7-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2054210-INQUIRE INQUIRE Ask for price

Biotin-Linked Monoclonal Antibody to Advanced Glycation End Product (AGE)

MBS2091058-INQUIRE INQUIRE Ask for price

Advanced Glycation End Product (AGE) Monoclonal Antibody (General), Biotinylated

4-MAB353Ge21-Biotin
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against General Advanced Glycation End Product (AGE). This antibody is labeled with Biotin.

Monoclonal Anti-BrdU produced in mouse Antibody

MBS415152-01mL 0.1mL
EUR 365

Monoclonal Anti-BrdU produced in mouse Antibody

MBS415152-5x01mL 5x0.1mL
EUR 1395

Fibrinogen Degradation Product D (D-Dimer) mouse monoclonal antibody, clone DD-5, Purified

BM417 200 µg Ask for price