Human Alu Antibody Monoclonal
Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the human alu antibody monoclonal reagents distributed by Genprice. The Human Alu Antibody Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Alu Group: Antibody Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Antibody Monoclonal information
Gelsolin (GS) Monoclonal Antibody (Human) |
|||
4-MAA372Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Gelsolin (GS) |
Insulin (INS) Monoclonal Antibody (Human) |
|||
4-MAA448Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Insulin (INS) |
Ferritin (FE) Monoclonal Antibody (Human) |
|||
4-MAA518Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Ferritin (FE) |
Visfatin (VF) Monoclonal Antibody (Human) |
|||
4-MAA638Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Visfatin (VF) |
Albumin (ALB) Monoclonal Antibody (Human) |
|||
4-MAB028Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Albumin (ALB) |
Relaxin (RLN) Monoclonal Antibody (Human) |
|||
4-MAB216Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Relaxin (RLN) |
Elastin (ELN) Monoclonal Antibody (Human) |
|||
4-MAB337Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Elastin (ELN) |
Lumican (LUM) Monoclonal Antibody (Human) |
|||
4-MAB496Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Lumican (LUM) |
Motilin (MTL) Monoclonal Antibody (Human) |
|||
4-MAA575Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Motilin (MTL) |
Reelin (RELN) Monoclonal Antibody (Human) |
|||
4-MAC775Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Reelin (RELN) |
Ubiquitin (Ub) Monoclonal Antibody (Human) |
|||
4-MAA164Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Ubiquitin (Ub) |
Copeptin (CPP) Monoclonal Antibody (Human) |
|||
4-MAA365Hu28 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Copeptin (CPP) |
Gelsolin (GSN) Monoclonal Antibody (Human) |
|||
4-MAA372Hu24 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Gelsolin (GSN) |
Nephrin (NPHN) Monoclonal Antibody (Human) |
|||
4-MAA937Hu21 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Nephrin (NPHN) |
Nephrin (NPHN) Monoclonal Antibody (Human) |
|||
4-MAA937Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Nephrin (NPHN) |
Podocin (PDCN) Monoclonal Antibody (Human) |
|||
4-MAA938Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Podocin (PDCN) |
Endoglin (ENG) Monoclonal Antibody (Human) |
|||
4-MAA980Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Endoglin (ENG) |