Human Monoclonal Antibody Sc-1
Monoclonal PP2A alpha and beta Antibody |
|||
AMM03147G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the human monoclonal antibody sc-1 reagents distributed by Genprice. The Human Monoclonal Antibody Sc-1 reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Sc-1
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Mouse Anti Human Igfbp-1 Monoclonal Antibody |
|||
CABT-48968MH | Creative Diagnostics | 0.2 mg | EUR 920.4 |
Angiopoietin 1 (ANGPT1) Monoclonal Antibody (Human) |
|||
4-MAA008Hu22 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Angiopoietin 1 (ANGPT1) |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC |
|||
4-MAE912Hu21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3 |
|||
4-MAE912Hu21-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP |
|||
4-MAE912Hu21-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC |
|||
4-MAE912Hu22-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3 |
|||
4-MAE912Hu22-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP |
|||
4-MAE912Hu22-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP. |
Histatin 1 (HTN1) Monoclonal Antibody (Human), APC |
|||
4-MAF487Hu21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with APC. |
Histatin 1 (HTN1) Monoclonal Antibody (Human), Cy3 |
|||
4-MAF487Hu21-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with Cy3. |
Histatin 1 (HTN1) Monoclonal Antibody (Human), HRP |
|||
4-MAF487Hu21-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with HRP. |
Gremlin 1 (GREM1) Monoclonal Antibody (Human), APC |
|||
4-MAC128Hu22-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with APC. |
Gremlin 1 (GREM1) Monoclonal Antibody (Human), Cy3 |
|||
4-MAC128Hu22-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with Cy3. |
Gremlin 1 (GREM1) Monoclonal Antibody (Human), HRP |
|||
4-MAC128Hu22-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with HRP. |
Atrophin 1 (ATN1) Monoclonal Antibody (Human), APC |
|||
4-MAC225Hu21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with APC. |
Atrophin 1 (ATN1) Monoclonal Antibody (Human), Cy3 |
|||
4-MAC225Hu21-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with Cy3. |
Atrophin 1 (ATN1) Monoclonal Antibody (Human), HRP |
|||
4-MAC225Hu21-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with HRP. |