Human Monoclonal Antibody Sc-1

Monoclonal PP2A alpha and beta Antibody
AMM03147G	Leading Biology	0.1ml	EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibody sc-1 reagents distributed by Genprice. The Human Monoclonal Antibody Sc-1 reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Sc-1

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Antibody Sc-1 information

Mouse Anti Human Igfbp-1 Monoclonal Antibody
CABT-48968MH	Creative Diagnostics	0.2 mg	EUR 920.4

Angiopoietin 1 (ANGPT1) Monoclonal Antibody (Human)
4-MAA008Hu22	Cloud-Clone	EUR 265.20 EUR 2536.80 EUR 642.00 EUR 328.80 EUR 243.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Angiopoietin 1 (ANGPT1)

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC
4-MAE912Hu21-APC	Cloud-Clone	EUR 436.80 EUR 4254.00 EUR 1176.00 EUR 560.40 EUR 272.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3
4-MAE912Hu21-Cy3	Cloud-Clone	EUR 532.80 EUR 5622.00 EUR 1518.00 EUR 697.20 EUR 313.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP
4-MAE912Hu21-HRP	Cloud-Clone	EUR 398.40 EUR 3706.80 EUR 1039.20 EUR 505.20 EUR 255.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC
4-MAE912Hu22-APC	Cloud-Clone	EUR 429.60 EUR 4146.00 EUR 1148.40 EUR 549.60 EUR 268.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3
4-MAE912Hu22-Cy3	Cloud-Clone	EUR 522.00 EUR 5478.00 EUR 1482.00 EUR 682.80 EUR 309.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP
4-MAE912Hu22-HRP	Cloud-Clone	EUR 392.40 EUR 3613.20 EUR 1015.20 EUR 495.60 EUR 253.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP.

Histatin 1 (HTN1) Monoclonal Antibody (Human), APC
4-MAF487Hu21-APC	Cloud-Clone	EUR 429.60 EUR 4146.00 EUR 1148.40 EUR 549.60 EUR 268.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with APC.

Histatin 1 (HTN1) Monoclonal Antibody (Human), Cy3
4-MAF487Hu21-Cy3	Cloud-Clone	EUR 522.00 EUR 5478.00 EUR 1482.00 EUR 682.80 EUR 309.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with Cy3.

Histatin 1 (HTN1) Monoclonal Antibody (Human), HRP
4-MAF487Hu21-HRP	Cloud-Clone	EUR 392.40 EUR 3613.20 EUR 1015.20 EUR 495.60 EUR 253.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with HRP.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), APC
4-MAC128Hu22-APC	Cloud-Clone	EUR 429.60 EUR 4146.00 EUR 1148.40 EUR 549.60 EUR 268.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with APC.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), Cy3
4-MAC128Hu22-Cy3	Cloud-Clone	EUR 522.00 EUR 5478.00 EUR 1482.00 EUR 682.80 EUR 309.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with Cy3.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), HRP
4-MAC128Hu22-HRP	Cloud-Clone	EUR 392.40 EUR 3613.20 EUR 1015.20 EUR 495.60 EUR 253.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with HRP.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), APC
4-MAC225Hu21-APC	Cloud-Clone	EUR 421.20 EUR 4038.00 EUR 1122.00 EUR 538.80 EUR 266.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with APC.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), Cy3
4-MAC225Hu21-Cy3	Cloud-Clone	EUR 512.40 EUR 5334.00 EUR 1446.00 EUR 668.40 EUR 304.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with Cy3.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), HRP
4-MAC225Hu21-HRP	Cloud-Clone	EUR 385.20 EUR 3519.60 EUR 992.40 EUR 486.00 EUR 250.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with HRP.