Human Monoclonal Antibody Sc-1

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibody sc-1 reagents distributed by Genprice. The Human Monoclonal Antibody Sc-1 reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Sc-1

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Antibody Sc-1 information

Mouse Anti Human Igfbp-1 Monoclonal Antibody

CABT-48968MH 0.2 mg
EUR 920.4

Angiopoietin 1 (ANGPT1) Monoclonal Antibody (Human)

4-MAA008Hu22
  • EUR 265.20
  • EUR 2536.80
  • EUR 642.00
  • EUR 328.80
  • EUR 243.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Angiopoietin 1 (ANGPT1)

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC

4-MAE912Hu21-APC
  • EUR 436.80
  • EUR 4254.00
  • EUR 1176.00
  • EUR 560.40
  • EUR 272.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3

4-MAE912Hu21-Cy3
  • EUR 532.80
  • EUR 5622.00
  • EUR 1518.00
  • EUR 697.20
  • EUR 313.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP

4-MAE912Hu21-HRP
  • EUR 398.40
  • EUR 3706.80
  • EUR 1039.20
  • EUR 505.20
  • EUR 255.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC

4-MAE912Hu22-APC
  • EUR 429.60
  • EUR 4146.00
  • EUR 1148.40
  • EUR 549.60
  • EUR 268.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3

4-MAE912Hu22-Cy3
  • EUR 522.00
  • EUR 5478.00
  • EUR 1482.00
  • EUR 682.80
  • EUR 309.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3.

Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP

4-MAE912Hu22-HRP
  • EUR 392.40
  • EUR 3613.20
  • EUR 1015.20
  • EUR 495.60
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP.

Histatin 1 (HTN1) Monoclonal Antibody (Human), APC

4-MAF487Hu21-APC
  • EUR 429.60
  • EUR 4146.00
  • EUR 1148.40
  • EUR 549.60
  • EUR 268.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with APC.

Histatin 1 (HTN1) Monoclonal Antibody (Human), Cy3

4-MAF487Hu21-Cy3
  • EUR 522.00
  • EUR 5478.00
  • EUR 1482.00
  • EUR 682.80
  • EUR 309.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with Cy3.

Histatin 1 (HTN1) Monoclonal Antibody (Human), HRP

4-MAF487Hu21-HRP
  • EUR 392.40
  • EUR 3613.20
  • EUR 1015.20
  • EUR 495.60
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with HRP.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), APC

4-MAC128Hu22-APC
  • EUR 429.60
  • EUR 4146.00
  • EUR 1148.40
  • EUR 549.60
  • EUR 268.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with APC.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), Cy3

4-MAC128Hu22-Cy3
  • EUR 522.00
  • EUR 5478.00
  • EUR 1482.00
  • EUR 682.80
  • EUR 309.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with Cy3.

Gremlin 1 (GREM1) Monoclonal Antibody (Human), HRP

4-MAC128Hu22-HRP
  • EUR 392.40
  • EUR 3613.20
  • EUR 1015.20
  • EUR 495.60
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Gremlin 1 (GREM1). This antibody is labeled with HRP.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), APC

4-MAC225Hu21-APC
  • EUR 421.20
  • EUR 4038.00
  • EUR 1122.00
  • EUR 538.80
  • EUR 266.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with APC.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), Cy3

4-MAC225Hu21-Cy3
  • EUR 512.40
  • EUR 5334.00
  • EUR 1446.00
  • EUR 668.40
  • EUR 304.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with Cy3.

Atrophin 1 (ATN1) Monoclonal Antibody (Human), HRP

4-MAC225Hu21-HRP
  • EUR 385.20
  • EUR 3519.60
  • EUR 992.40
  • EUR 486.00
  • EUR 250.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Atrophin 1 (ATN1). This antibody is labeled with HRP.