Human IgA (secretory) mouse monoclonal antibody, clone SC-05, Purified |
SM3073P |
Origene Technologies GmbH |
100 µg |
Ask for price |
Human Monoclonal Laboratories manufactures the human monoclonal antibody sc-1 reagents distributed by Genprice. The Human Monoclonal Antibody Sc-1 reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Sc-1
SC-PEG-SC |
Abbexa |
0.8 kDa; 1 g |
EUR 393.6 |
|
SC-PEG-SC |
Abbexa |
10 kDa; 1 g |
EUR 393.6 |
|
SC-PEG-SC |
Abbexa |
20 kDa; 1 g |
EUR 393.6 |
|
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Antibody Sc-1 information
Fibulin 1 (FBLN1) Monoclonal Antibody (Human), PE |
4-MAC472Hu22-PE |
Cloud-Clone |
-
EUR 367.20
-
EUR 3340.80
-
EUR 943.20
-
EUR 463.20
-
EUR 238.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Fibulin 1 (FBLN1). This antibody is labeled with PE. |
Angiopoietin 1 (ANGPT1) Monoclonal Antibody (Human) |
4-MAA008Hu22 |
Cloud-Clone |
-
EUR 265.20
-
EUR 2536.80
-
EUR 642.00
-
EUR 328.80
-
EUR 243.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Angiopoietin 1 (ANGPT1) |
Human CD3 Monoclonal antibody |
3PPC5.5-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Human CD5 Monoclonal antibody |
5A1-100T |
ImmunoStep |
100 test |
EUR 248.6 |
Human CD5 Monoclonal antibody |
5F1-100T |
ImmunoStep |
100 test |
EUR 204.6 |
Human CD5 Monoclonal antibody |
5PE1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD5 Monoclonal antibody |
5PPC5.51-100T |
ImmunoStep |
100 test |
EUR 292.6 |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC |
4-MAE912Hu21-APC |
Cloud-Clone |
-
EUR 436.80
-
EUR 4254.00
-
EUR 1176.00
-
EUR 560.40
-
EUR 272.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3 |
4-MAE912Hu21-Cy3 |
Cloud-Clone |
-
EUR 532.80
-
EUR 5622.00
-
EUR 1518.00
-
EUR 697.20
-
EUR 313.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP |
4-MAE912Hu21-HRP |
Cloud-Clone |
-
EUR 398.40
-
EUR 3706.80
-
EUR 1039.20
-
EUR 505.20
-
EUR 255.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), APC |
4-MAE912Hu22-APC |
Cloud-Clone |
-
EUR 429.60
-
EUR 4146.00
-
EUR 1148.40
-
EUR 549.60
-
EUR 268.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with APC. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), Cy3 |
4-MAE912Hu22-Cy3 |
Cloud-Clone |
-
EUR 522.00
-
EUR 5478.00
-
EUR 1482.00
-
EUR 682.80
-
EUR 309.60
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with Cy3. |
Sirtuin 1 (SIRT1) Monoclonal Antibody (Human), HRP |
4-MAE912Hu22-HRP |
Cloud-Clone |
-
EUR 392.40
-
EUR 3613.20
-
EUR 1015.20
-
EUR 495.60
-
EUR 253.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Sirtuin 1 (SIRT1). This antibody is labeled with HRP. |
Histatin 1 (HTN1) Monoclonal Antibody (Human), APC |
4-MAF487Hu21-APC |
Cloud-Clone |
-
EUR 429.60
-
EUR 4146.00
-
EUR 1148.40
-
EUR 549.60
-
EUR 268.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Histatin 1 (HTN1). This antibody is labeled with APC. |