Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the human monoclonal antibody rapatha reagents distributed by Genprice. The Human Monoclonal Antibody Rapatha reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Rapatha
Dog True insulin ELISA kit |
|
BlueGene |
192 tests |
EUR 1524 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog True insulin ELISA kit |
|
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
|
|
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Antibody Rapatha information
RAP1A + RAP1B (10R11) Rabbit Monoclonal Antibody |
|
E28M6263 |
EnoGene |
100ul |
EUR 295 |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human) |
|
4-MAB806Hu21 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) |
Rapid Human Monoclonal Antibody Isotyping Kit (5 |
|
ISO-Hu-5 |
Antagene |
5 tests |
EUR 136 |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC |
|
4-MAB806Hu21-APC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC. |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), Cy3 |
|
4-MAB806Hu21-Cy3 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with Cy3. |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), HRP |
|
4-MAB806Hu21-HRP |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with HRP. |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), PE |
|
4-MAB806Hu21-PE |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with PE. |
Monoclonal antibody to human IgG for rapid test |
|
MBS596150-1mg |
MyBiosource |
1mg |
EUR 480 |
Monoclonal antibody to human IgG for rapid test |
|
MBS596150-2mg |
MyBiosource |
2mg |
EUR 700 |
Monoclonal antibody to human IgG for rapid test |
|
MBS596150-5mg |
MyBiosource |
5mg |
EUR 1505 |
Monoclonal antibody to human IgM for rapid test |
|
MBS596151-1mg |
MyBiosource |
1mg |
EUR 480 |
Monoclonal antibody to human IgM for rapid test |
|
MBS596151-2mg |
MyBiosource |
2mg |
EUR 700 |
Monoclonal antibody to human IgM for rapid test |
|
MBS596151-5mg |
MyBiosource |
5mg |
EUR 1505 |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), FITC |
|
4-MAB806Hu21-FITC |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with FITC. |
FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC-Cy7 |
|
4-MAB806Hu21-APC-Cy7 |
Cloud-Clone |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 20ul
- 100ul
- 200ul
- 1ml
- 10ml
|
|
|
|
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC-Cy7. |