Human Monoclonal Antibody Rapatha

Monoclonal antibody for SUR1 and SUR2B
SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody rapatha reagents distributed by Genprice. The Human Monoclonal Antibody Rapatha reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Rapatha

True Blue Chloride
100mg
EUR 11200
Description: 71431-30-6

True Blue Chloride
100 mg Ask for price

True Blue Diaceturate Salt
100mg
EUR 15000
Description: 108321-12-6

True Blue Diaceturate Salt
100 mg Ask for price

True north Cryobox1.5/2mLNatural
PK10
EUR 129.6

True Blue (TB) Diaceturate Salt
1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt
5mg Ask for price
Description: 108321-12-6

Antibody Rapatha information

RAP1A + RAP1B (10R11) Rabbit Monoclonal Antibody
E28M6263 100ul
EUR 295

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human)
4-MAB806Hu21
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP)

Rapid Human Monoclonal Antibody Isotyping Kit (5
ISO-Hu-5 5 tests
EUR 136

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC
4-MAB806Hu21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), Cy3
4-MAB806Hu21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with Cy3.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), HRP
4-MAB806Hu21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with HRP.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), PE
4-MAB806Hu21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with PE.

Monoclonal antibody to human IgG for rapid test
MBS596150-1mg 1mg
EUR 480

Monoclonal antibody to human IgG for rapid test
MBS596150-2mg 2mg
EUR 700

Monoclonal antibody to human IgG for rapid test
MBS596150-5mg 5mg
EUR 1505

Monoclonal antibody to human IgM for rapid test
MBS596151-1mg 1mg
EUR 480

Monoclonal antibody to human IgM for rapid test
MBS596151-2mg 2mg
EUR 700

Monoclonal antibody to human IgM for rapid test
MBS596151-5mg 5mg
EUR 1505

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), FITC
4-MAB806Hu21-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with FITC.

RAP1A mouse monoclonal antibody, clone 5F8, Purified
AM06750PU-N 100 µg Ask for price

RAP1A mouse monoclonal antibody, clone 5F8G2, Purified
AM06751PU-N 100 µg Ask for price

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC-Cy7
4-MAB806Hu21-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC-Cy7.