Human Monoclonal Antibody Rapatha

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody rapatha reagents distributed by Genprice. The Human Monoclonal Antibody Rapatha reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Rapatha

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Dog True insulin ELISA kit

192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog True insulin ELISA kit

1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Canine True insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Antibody Rapatha information

RAP1A + RAP1B (10R11) Rabbit Monoclonal Antibody

E28M6263 100ul
EUR 295

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human)

4-MAB806Hu21
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP)

Rapid Human Monoclonal Antibody Isotyping Kit (5

ISO-Hu-5 5 tests
EUR 136

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC

4-MAB806Hu21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), Cy3

4-MAB806Hu21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with Cy3.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), HRP

4-MAB806Hu21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with HRP.

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), PE

4-MAB806Hu21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with PE.

Monoclonal antibody to human IgG for rapid test

MBS596150-1mg 1mg
EUR 480

Monoclonal antibody to human IgG for rapid test

MBS596150-2mg 2mg
EUR 700

Monoclonal antibody to human IgG for rapid test

MBS596150-5mg 5mg
EUR 1505

Monoclonal antibody to human IgM for rapid test

MBS596151-1mg 1mg
EUR 480

Monoclonal antibody to human IgM for rapid test

MBS596151-2mg 2mg
EUR 700

Monoclonal antibody to human IgM for rapid test

MBS596151-5mg 5mg
EUR 1505

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), FITC

4-MAB806Hu21-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with FITC.

RAP1A mouse monoclonal antibody, clone 5F8, Purified

AM06750PU-N 100 µg Ask for price

RAP1A mouse monoclonal antibody, clone 5F8G2, Purified

AM06751PU-N 100 µg Ask for price

FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) Monoclonal Antibody (Human), APC-Cy7

4-MAB806Hu21-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Human FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP). This antibody is labeled with APC-Cy7.